PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g07900.1
Common NameLR48_Vigan01g232500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 274aa    MW: 30670.2 Da    PI: 5.1397
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g07900.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.71e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
   Vang11g07900.1 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.074965IPR017930Myb domain
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002491.5E-141461IPR001005SANT/Myb domain
SuperFamilySSF466891.36E-201688IPR009057Homeodomain-like
CDDcd001671.48E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.5E-76588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGRHSCCVKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNREM FLNKPALDPL SYYDFPMGAA QSGFNLPMSQ  120
YQTSLKASDQ SPFGPNSSYG FLSLPSLTNS DHGNVSVTEF SDNNSASKIS SLLMNEQVKE  180
SSSNSSNMST IYAGGGCHIS SMMENASFSW EGDNKFDPLF QFQVNATKSE DFKTSPWEEG  240
QLQTRNSIDF TSFPLTSLSE DLTGENFDVF QHI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-141288580B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014490587.11e-120PREDICTED: protein ODORANT1-like
TrEMBLA0A0L9TRG41e-123A0A0L9TRG4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3R6401e-123A0A0S3R640_PHAAN; Uncharacterized protein
STRINGGLYMA05G02550.21e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.14e-54myb domain protein 86
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]